PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G340900.1.p
Common NameSb01g032770, SORBIDRAFT_01g032770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 295aa    MW: 32399.6 Da    PI: 6.7197
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G340900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT  Ed++lv +++++G g W + +r+ g++R++k+c++rw++yl
  Sobic.001G340900.1.p 14 RGAWTSMEDDILVSYIQKHGEGKWGSLPRRAGLKRCGKSCRLRWLNYL 61
                          89********************************************97 PP

2Myb_DNA-binding51.22.8e-1667111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Sobic.001G340900.1.p  67 RGNISDDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                           78999*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.954961IPR017930Myb domain
SuperFamilySSF466891.29E-2712108IPR009057Homeodomain-like
SMARTSM007178.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-221568IPR009057Homeodomain-like
CDDcd001676.66E-101661No hitNo description
PROSITE profilePS5129424.95462116IPR017930Myb domain
SMARTSM007172.1E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2469116IPR009057Homeodomain-like
CDDcd001676.24E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRKPCCPKE GLNRGAWTSM EDDILVSYIQ KHGEGKWGSL PRRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI SDDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKKVLKNS  120
GGLKEDSEAA GASSKRRPFS EPTRTVSDTA AQAHARGRPP EPPEASLVRS KALRCTRTAM  180
MLPVAQPTAH ARHGRALETA AGDDHVKAEQ TVVVVKAPTV EVRQDHLPED DLPIDIDLDL  240
DFDMGEMGFL SPWRGEVADG IEPGGQFGGG ELDDLEALLL GPGGDDDVHE FAWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4799280.0GU479928.1 Sorghum bicolor MYB1 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465146.10.0hypothetical protein SORBIDRAFT_01g032770
TrEMBLC5WWN50.0C5WWN5_SORBI; Putative uncharacterized protein Sb01g032770
STRINGSb01g032770.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-53myb domain protein 3